PDB entry 5yr3

View 5yr3 on RCSB PDB site
Description: Structure of sfYFP66BPA
Class: fluorescent protein
Keywords: Bioluminescence Protein Chromophore Linkage, FLUORESCENT PROTEIN
Deposited on 2017-11-08, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yellow fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: yfp
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIR9 (0-224)
      • engineered mutation (26)
      • engineered mutation (35)
      • engineered mutation (44)
      • chromophore (61)
      • engineered mutation (62)
      • engineered mutation (99)
      • engineered mutation (105)
      • engineered mutation (122)
      • engineered mutation (142)
      • engineered mutation (160-161)
      • engineered mutation (197)
      • engineered mutation (199-200)
    Domains in SCOPe 2.07: d5yr3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yr3A (A:)
    geelftgvvpilveldgdvnghkfsvrgegegdatigkltlkfisttgklpvpwptlvtt
    lxlqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvnriel
    kgtdfkedgnilghkleynfnsenvyitadkqkngikanftvrhnvedgsvqladhyqqn
    tpigdgpvllpdnhylsdqtvlskdpnekrdhmvllefvtaagit