PDB entry 5yqt

View 5yqt on RCSB PDB site
Description: Crystal Structure of the L74F/M78V/I80V/L114F mutant of LEH complexed with cyclopentene oxide
Class: hydrolase
Keywords: epoxide hydrolase, HYDROLASE
Deposited on 2017-11-07, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-End)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqta_
  • Chain 'B':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-154)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqtb_
  • Chain 'C':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-End)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqtc_
  • Chain 'D':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-154)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqtd_
  • Chain 'E':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqte_
  • Chain 'F':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-End)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqtf_
  • Chain 'G':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-End)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqtg_
  • Chain 'H':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (10-End)
      • engineered mutation (79)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5yqth_
  • Heterogens: 3ZS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yqtA (A:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtA (A:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeeavdlplr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yqtB (B:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtB (B:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeeavdlplrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yqtC (C:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtC (C:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeeavdlplr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yqtD (D:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtD (D:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeeavdlplrg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5yqtE (E:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtE (E:)
    eqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygrd
    aveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlteg
    kitgwrdyfdlrefeeavdl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5yqtF (F:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtF (F:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeeavdl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5yqtG (G:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtG (G:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeea
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5yqtH (H:)
    mhhhhhhtslieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynf
    silgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqtH (H:)
    ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
    daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
    gkitgwrdyfdlrefeeavdlp