PDB entry 5yql

View 5yql on RCSB PDB site
Description: Crystal structure of Sirt2 in complex with selective inhibitor A2I
Class: hydrolase/hydrolase inhibitor
Keywords: NAD-dependent deacetylase sirtuin-2, Inhibitor, Complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-11-07, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IXJ6 (5-305)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d5yqla1, d5yqla2
  • Heterogens: A2I, ZN, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yqlA (A:)
    gasgserlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnleky
    hlpypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnid
    tleriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkp
    divffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkeka
    gqsdpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrreha
    sidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqlA (A:)
    gasgserlldeltlegvarymqsercrrviclvgagistsagipdfrspstgllekyhlp
    ypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtle
    riagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdiv
    ffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqs
    dpflggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs