PDB entry 5yqa

View 5yqa on RCSB PDB site
Description: The crystal structure of CYP199A4 binding with 4-n-Propyl benzoic acid
Class: oxidoreductase
Keywords: Cytochrome P450; metabolites biosynthesis; catabolism Cytoplasm, OXIDOREDUCTASE
Deposited on 2017-11-06, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris (strain HaA2) [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yqaa_
  • Heterogens: HEM, 8ZU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yqaA (A:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqaA (A:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa