PDB entry 5ypt

View 5ypt on RCSB PDB site
Description: Crystal structure of Marchantia paleacea chalone synthase like 1 (CHSL1)
Class: transferase
Keywords: chalcone synthase, pks type III, chsl1, transferase
Deposited on 2017-11-03, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stilbenecarboxylate synthase 1
    Species: Marchantia polymorpha [TaxId:3197]
    Gene: STCS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypta1, d5ypta2
  • Chain 'B':
    Compound: Stilbenecarboxylate synthase 1
    Species: Marchantia polymorpha [TaxId:3197]
    Gene: STCS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yptb1, d5yptb2
  • Chain 'C':
    Compound: Stilbenecarboxylate synthase 1
    Species: Marchantia polymorpha [TaxId:3197]
    Gene: STCS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yptc1, d5yptc2
  • Chain 'D':
    Compound: Stilbenecarboxylate synthase 1
    Species: Marchantia polymorpha [TaxId:3197]
    Gene: STCS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yptd1, d5yptd2
  • Chain 'E':
    Compound: Stilbenecarboxylate synthase 1
    Species: Marchantia polymorpha [TaxId:3197]
    Gene: STCS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypte1, d5ypte2
  • Chain 'F':
    Compound: Stilbenecarboxylate synthase 1
    Species: Marchantia polymorpha [TaxId:3197]
    Gene: STCS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yptf1, d5yptf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yptA (A:)
    gsgmketaaakferqhmdspdlgtddddkamadigsmanivnaaaykhrraagpatvlai
    gkatpptaysqseypdfffditntshktelkakfaricknsgintryfhctedilkanps
    mctylepsldvrqdiairevprlaekaaiealaewgqprdqithvvfattsgvnmpgadl
    tltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvltvvseltcvtfrapn
    eehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilpesdgaiegrlteag
    lifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggraildevaktlslkpe
    kleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewglvvgfgpgltvevs
    vlraiatgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yptA (A:)
    ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
    ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
    vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
    tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetil
    pesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggr
    aildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcew
    glvvgfgpgltvevsvlraiatgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yptB (B:)
    gsgmketaaakferqhmdspdlgtddddkamadigsmanivnaaaykhrraagpatvlai
    gkatpptaysqseypdfffditntshktelkakfaricknsgintryfhctedilkanps
    mctylepsldvrqdiairevprlaekaaiealaewgqprdqithvvfattsgvnmpgadl
    tltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvltvvseltcvtfrapn
    eehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilpesdgaiegrlteag
    lifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggraildevaktlslkpe
    kleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewglvvgfgpgltvevs
    vlraiatgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yptB (B:)
    khrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgintr
    yfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithvv
    fattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvlt
    vvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilp
    esdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggra
    ildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewg
    lvvgfgpgltvevsvlraiatgh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yptC (C:)
    gsgmketaaakferqhmdspdlgtddddkamadigsmanivnaaaykhrraagpatvlai
    gkatpptaysqseypdfffditntshktelkakfaricknsgintryfhctedilkanps
    mctylepsldvrqdiairevprlaekaaiealaewgqprdqithvvfattsgvnmpgadl
    tltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvltvvseltcvtfrapn
    eehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilpesdgaiegrlteag
    lifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggraildevaktlslkpe
    kleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewglvvgfgpgltvevs
    vlraiatgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yptC (C:)
    ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
    ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
    vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
    tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetil
    pesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggr
    aildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcew
    glvvgfgpgltvevsvlraiatgh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yptD (D:)
    gsgmketaaakferqhmdspdlgtddddkamadigsmanivnaaaykhrraagpatvlai
    gkatpptaysqseypdfffditntshktelkakfaricknsgintryfhctedilkanps
    mctylepsldvrqdiairevprlaekaaiealaewgqprdqithvvfattsgvnmpgadl
    tltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvltvvseltcvtfrapn
    eehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilpesdgaiegrlteag
    lifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggraildevaktlslkpe
    kleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewglvvgfgpgltvevs
    vlraiatgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yptD (D:)
    ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
    ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
    vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
    tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetil
    pesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggr
    aildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcew
    glvvgfgpgltvevsvlraiatgh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5yptE (E:)
    gsgmketaaakferqhmdspdlgtddddkamadigsmanivnaaaykhrraagpatvlai
    gkatpptaysqseypdfffditntshktelkakfaricknsgintryfhctedilkanps
    mctylepsldvrqdiairevprlaekaaiealaewgqprdqithvvfattsgvnmpgadl
    tltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvltvvseltcvtfrapn
    eehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilpesdgaiegrlteag
    lifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggraildevaktlslkpe
    kleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewglvvgfgpgltvevs
    vlraiatgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yptE (E:)
    ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
    ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
    vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
    tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetil
    pesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggr
    aildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcew
    glvvgfgpgltvevsvlraiatgh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5yptF (F:)
    gsgmketaaakferqhmdspdlgtddddkamadigsmanivnaaaykhrraagpatvlai
    gkatpptaysqseypdfffditntshktelkakfaricknsgintryfhctedilkanps
    mctylepsldvrqdiairevprlaekaaiealaewgqprdqithvvfattsgvnmpgadl
    tltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvltvvseltcvtfrapn
    eehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetilpesdgaiegrlteag
    lifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggraildevaktlslkpe
    kleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcewglvvgfgpgltvevs
    vlraiatgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yptF (F:)
    ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
    ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
    vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
    tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekpqfeihwsgetil
    pesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspswndlfwcvhpggr
    aildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsaekksrttgegcew
    glvvgfgpgltvevsvlraiatgh