PDB entry 5yps

View 5yps on RCSB PDB site
Description: The structural basis of histone chaperoneVps75
Class: chaperone
Keywords: Histone chaperone, acetylation, chaperone
Deposited on 2017-11-03, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 75
    Species: Pneumocystis carinii B80 [TaxId:1408658]
    Gene: T552_02523
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W4ZF97
      • engineered mutation (55)
      • engineered mutation (126)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ypsa_
  • Chain 'B':
    Compound: Vacuolar protein sorting-associated protein 75
    Species: Pneumocystis carinii B80 [TaxId:1408658]
    Gene: T552_02523
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W4ZF97
      • engineered mutation (55)
      • engineered mutation (126)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ypsb_
  • Chain 'C':
    Compound: Vacuolar protein sorting-associated protein 75
    Species: Pneumocystis carinii B80 [TaxId:1408658]
    Gene: T552_02523
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W4ZF97
      • engineered mutation (55)
      • engineered mutation (126)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ypsc_
  • Chain 'D':
    Compound: Vacuolar protein sorting-associated protein 75
    Species: Pneumocystis carinii B80 [TaxId:1408658]
    Gene: T552_02523
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W4ZF97
      • engineered mutation (55)
      • engineered mutation (126)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ypsd_
  • Chain 'E':
    Compound: Vacuolar protein sorting-associated protein 75
    Species: Pneumocystis carinii B80 [TaxId:1408658]
    Gene: T552_02523
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W4ZF97
      • engineered mutation (55)
      • engineered mutation (126)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ypse_
  • Chain 'F':
    Compound: Vacuolar protein sorting-associated protein 75
    Species: Pneumocystis carinii B80 [TaxId:1408658]
    Gene: T552_02523
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0W4ZF97
      • engineered mutation (55)
      • engineered mutation (126)
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5ypsf_
  • Heterogens: CA, 1PE, PEG, GOL, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ypsA (A:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekramvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslylmklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypsA (A:)
    ttsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdels
    vyispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkae
    asssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeela
    ifiaedlypnavkyftdalqen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ypsB (B:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekramvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslylmklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypsB (B:)
    tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv
    yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea
    sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai
    fiaedlypnavkyftdalqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ypsC (C:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekramvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslylmklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypsC (C:)
    tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv
    yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea
    sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai
    fiaedlypnavkyftdalqen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ypsD (D:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekramvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslylmklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypsD (D:)
    tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv
    yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea
    sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai
    fiaedlypnavkyftdalqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ypsE (E:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekramvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslylmklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypsE (E:)
    tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv
    yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea
    sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai
    fiaedlypnavkyftdalqene
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ypsF (F:)
    msakktnekrseiqsetnttsldevadielefekadvellkhqvelfnplyekramvlrk
    ipkfwpiaieaapsdelsvyispedanvlehlidlrvyrpnedprdikivfefeaneyle
    snslylmklfryssqkaeasssninkepsqlisekvniewkknkdltrqtkgtapsfftw
    fswtgkendifedeeelaifiaedlypnavkyftdalqeneenedeeidlenengdnise
    eepskkrtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypsF (F:)
    tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv
    yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea
    sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai
    fiaedlypnavkyftdalqen