PDB entry 5ypq

View 5ypq on RCSB PDB site
Description: Crystal structure of sulfated dehydroquinate dehydratase from Acinetobacter baumannii at 2.65 A resolution
Class: lyase
Keywords: lyase
Deposited on 2017-11-02, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqa_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqb_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqc_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqd_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqe_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqf_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqg_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqh_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqi_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypqk_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypql_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ypqA (A:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqA (A:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ypqB (B:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqB (B:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ypqC (C:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqC (C:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ypqD (D:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqD (D:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ypqE (E:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqE (E:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ypqF (F:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqF (F:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ypqG (G:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqG (G:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ypqH (H:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqH (H:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ypqI (I:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqI (I:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ypqJ (J:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqJ (J:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ypqK (K:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqK (K:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ypqL (L:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypqL (L:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp