PDB entry 5yoz

View 5yoz on RCSB PDB site
Description: Solution structure of truncated Rab5a from Leishmania donovani
Class: endocytosis
Keywords: Rab, GTPase, early endocytosis, GTP hydrolysing activity, ENDOCYTOSIS
Deposited on 2017-10-31, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab5a
    Species: Leishmania donovani [TaxId:5661]
    Gene: Rab5a
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A109NYM0 (2-176)
      • engineered mutation (59-60)
      • engineered mutation (73)
      • engineered mutation (88)
    Domains in SCOPe 2.07: d5yoza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yozA (A:)
    gsmnthppqlmeatsakivmlgesgagkssialrftrneflanqettigaaflsktvmid
    gralkyeiwdtaglerfrslapiyyrgasgalvvyditnseslkkaqtwikelranadps
    liivlvgnkkdlgslrqvsfedgqrlaaeeqlaafyeasakdnnnveqvfldlaakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yozA (A:)
    mnthppqlmeatsakivmlgesgagkssialrftrneflanqettigaaflsktvmidgr
    alkyeiwdtaglerfrslapiyyrgasgalvvyditnseslkkaqtwikelranadpsli
    ivlvgnkkdlgslrqvsfedgqrlaaeeqlaafyeasakdnnnveqvfldlaakl