PDB entry 5yoj

View 5yoj on RCSB PDB site
Description: Structure of A17 HIV-1 Protease in Complex with Inhibitor KNI-1657
Class: hydrolase/hydrolase inhibitor
Keywords: inhibitor, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-10-29, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A17 HIV-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YOJ (Start-99)
    Domains in SCOPe 2.07: d5yoja_
  • Chain 'B':
    Compound: A17 HIV-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YOJ (Start-99)
    Domains in SCOPe 2.07: d5yojb_
  • Heterogens: 8Z0, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yojA (A:)
    mpqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvrey
    dqiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yojA (A:)
    pqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvreyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yojB (B:)
    mpqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvrey
    dqiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yojB (B:)
    pqitlwkrpfvtikiggqlkealldtgaddtiieemslpgrwkpkivggiggfikvreyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf