PDB entry 5yog

View 5yog on RCSB PDB site
Description: Crystal Structure of flavodoxin with engineered disulfide bond N14C-C93
Class: electron transport
Keywords: fusion partner, FMN-binding protein, oxidation, ELECTRON TRANSPORT
Deposited on 2017-10-27, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303) [TaxId:882]
    Gene: DVU_2680
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (2-147)
      • expression tag (0-1)
      • engineered mutation (13)
      • engineered mutation (97)
    Domains in SCOPe 2.07: d5yoga1, d5yoga2
  • Heterogens: FMN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yogA (A:)
    aakalivygsttgcteytaetiareladagyevdsrdaasveagglfegfdlvllgcstw
    gddsielqddfiplfdsleetgaqgrkvacfgcgdssweyfcgavdaieeklknlgaeiv
    qdglridgdpraarddivgwahdvrgai