PDB entry 5yof

View 5yof on RCSB PDB site
Description: Crystal structure of zika virus NS3 protease in complex with a dipeptide inhibitor
Class: viral protein/inhibitor
Keywords: serine protease, viral non-structural protein, zika virus protease, VIRAL PROTEIN-INHIBITOR complex
Deposited on 2017-10-27, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS2B cofactor
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YOF
    Domains in SCOPe 2.07: d5yofa_
  • Chain 'B':
    Compound: NS3 protease
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YOF
    Domains in SCOPe 2.07: d5yofb_
  • Heterogens: 7HS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yofA (A:)
    mtgksvdmyieragditwekdaevtgnsprldvaldesgdfslveedgppmre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yofA (A:)
    dmyieragditwekdaevtgnsprldvaldesgdfslve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yofB (B:)
    gsgalwdvpapkevkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalr
    sgegrldpywgdvkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktk
    dgdigavaldypagtsgspildksgrviglygngvvikngsyvsaitqgkreeetpve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yofB (B:)
    gettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqd
    lvsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagts
    gspildksgrviglygngvvikngsyvsaitqgkre