PDB entry 5yo5

View 5yo5 on RCSB PDB site
Description: Crystal Structure of B562RIL with engineered disulfide bond A20C-Q25C
Class: electron transport
Keywords: hemoprotein, fusion partner, helix bundle, ELECTRON TRANSPORT
Deposited on 2017-10-26, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • expression tag (0)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5a1, d5yo5a2
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • expression tag (0)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5c1, d5yo5c2
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5d_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5e_
  • Chain 'F':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5f_
  • Chain 'G':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (Start-106)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5g_
  • Chain 'H':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (1-106)
      • engineered mutation (7)
      • engineered mutation (20)
      • engineered mutation (25)
      • engineered mutation (102)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5yo5h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yo5A (A:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yo5B (B:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yo5B (B:)
    adlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yo5C (C:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yo5D (D:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yo5D (D:)
    adlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5yo5E (E:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yo5E (E:)
    adlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5yo5F (F:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yo5F (F:)
    adlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5yo5G (G:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yo5G (G:)
    dlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkdf
    rhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5yo5H (H:)
    aadlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemk
    dfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yo5H (H:)
    adlednwetlndnlkviekcdnaacvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl