PDB entry 5yo4

View 5yo4 on RCSB PDB site
Description: Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
Class: electron transport
Keywords: hemoprotein, fusion partner, helix bundle, ELECTRON TRANSPORT
Deposited on 2017-10-26, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (6)
      • engineered mutation (26)
      • engineered mutation (78)
      • engineered mutation (101)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5yo4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yo4A (A:)
    adlednwetlndnlkviekadnaaqvcdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklcnegkvkeaqaaaeqlkttrnayiqkyl