PDB entry 5yng

View 5yng on RCSB PDB site
Description: Crystal structure of SZ348 in complex with cyclopentene oxide
Class: hydrolase
Keywords: epoxide hydrolase, cyclopentene oxide, HYDROLASE
Deposited on 2017-10-24, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (7-154)
      • expression tag (1-6)
      • engineered mutation (85)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5ynga1, d5ynga2
  • Chain 'B':
    Compound: limonene-1,2-epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: limA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZAG3 (Start-154)
      • engineered mutation (85)
      • engineered mutation (119)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5yngb_
  • Heterogens: K, NI, 3ZS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yngA (A:)
    mhhhhhhtskieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlaglftvmsydavetfhigssnglvytervdvlralptgksynv
    svlgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yngA (A:)
    hhhhhhtskieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqn
    mplppaygrdaveqtlaglftvmsydavetfhigssnglvytervdvlralptgksynvs
    vlgvfqltegkitgwrdyfdlrefeeavdlplrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yngB (B:)
    mhhhhhhtskieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyq
    nmplppaygrdaveqtlaglftvmsydavetfhigssnglvytervdvlralptgksynv
    svlgvfqltegkitgwrdyfdlrefeeavdlplrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yngB (B:)
    kieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppayg
    rdaveqtlaglftvmsydavetfhigssnglvytervdvlralptgksynvsvlgvfqlt
    egkitgwrdyfdlrefeeavdlplrg