PDB entry 5ymu

View 5ymu on RCSB PDB site
Description: Functional and structural characterization of P[19] rotavirus VP8* interaction with histo-blood group antigens
Class: viral protein
Keywords: Rotavirus, P[19] VP8*, VIRAL PROTEIN
Deposited on 2017-10-22, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Porcine rotavirus A [TaxId:10967]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YMU (0-159)
    Domains in SCOPe 2.07: d5ymua_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Porcine rotavirus A [TaxId:10967]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YMU (0-159)
    Domains in SCOPe 2.07: d5ymub_
  • Chain 'C':
    Compound: Outer capsid protein VP4
    Species: Porcine rotavirus A [TaxId:10967]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YMU (0-159)
    Domains in SCOPe 2.07: d5ymuc_
  • Chain 'D':
    Compound: Outer capsid protein VP4
    Species: Porcine rotavirus A [TaxId:10967]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YMU (0-159)
    Domains in SCOPe 2.07: d5ymud_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ymuA (A:)
    vldgpyqptrfkppndywillsptnqqvvlegtnrtdvwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkfyemfrnsasaefqhkrtltsdtklagflkhggrvwtfygetpha
    ttdysstsnlsevetvirtefyiiprsqeskcneyintgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ymuB (B:)
    vldgpyqptrfkppndywillsptnqqvvlegtnrtdvwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkfyemfrnsasaefqhkrtltsdtklagflkhggrvwtfygetpha
    ttdysstsnlsevetvirtefyiiprsqeskcneyintgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ymuC (C:)
    vldgpyqptrfkppndywillsptnqqvvlegtnrtdvwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkfyemfrnsasaefqhkrtltsdtklagflkhggrvwtfygetpha
    ttdysstsnlsevetvirtefyiiprsqeskcneyintgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ymuD (D:)
    vldgpyqptrfkppndywillsptnqqvvlegtnrtdvwvalllvepnvtnqsrqytlfg
    etkqitvenntnkwkfyemfrnsasaefqhkrtltsdtklagflkhggrvwtfygetpha
    ttdysstsnlsevetvirtefyiiprsqeskcneyintgl