PDB entry 5ym8

View 5ym8 on RCSB PDB site
Description: Crystal Structure of porcine delta coronavirus nsp9-N7
Class: RNA binding protein
Keywords: Porcine delta coronavirus, RNA binding protein, nsp9
Deposited on 2017-10-21, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nsp9
    Species: Porcine coronavirus HKU15 [TaxId:1159905]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ym8a_
  • Chain 'B':
    Compound: nsp9
    Species: Porcine coronavirus HKU15 [TaxId:1159905]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ym8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ym8A (A:)
    nvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgktvlnldp
    pmrfahtvggkqsvvylyfiqnisslnrgmvighisettilqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ym8A (A:)
    nvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtclttgktvlnldpp
    mrfasvvylyfiqnisslnrgmvighiset
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ym8B (B:)
    nvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtcltetgktvlnldp
    pmrfahtvggkqsvvylyfiqnisslnrgmvighisettilqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ym8B (B:)
    nvftaqntaqdfngnestvksfyvtrtgkkilvaitstkdnlktvtclttgktvlnldpp
    mrfahtvggkqsvvylyfiqnisslnrgmvighisetti