PDB entry 5yly

View 5yly on RCSB PDB site
Description: Crystal structure of the cytochrome b5 reductase domain of Ulva prolifera nitrate reductase
Class: flavoprotein
Keywords: cytochrome b5 reductase domain, FAD, Ulva prolifera, nitrate reductase, FLAVOPROTEIN
Deposited on 2017-10-20, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrate reductase
    Species: Ulva prolifera [TaxId:3117]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YLY (Start-291)
    Domains in SCOPe 2.07: d5ylya1, d5ylya2
  • Chain 'B':
    Compound: nitrate reductase
    Species: Ulva prolifera [TaxId:3117]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YLY (Start-291)
    Domains in SCOPe 2.07: d5ylyb1, d5ylyb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ylyA (A:)
    gamdaavvvmpgtaaaplpaidvdapflnpkkqkaaelkekikishdvtlfrfglehdeq
    llglptgkhmlirkkvtnaegdeevvmraytpttanetrghfdlvvkiykanvhpkfpeg
    gkfsqilealevgdtvevkgpighfhydrpghyknhklesevkrinmiaggtgltpmyqv
    mkailsnpsdlteirllyanqteadillrpelealakshpdrvkihytvdrptpgwkyss
    gfidldmceralfryepgtisvlcgpppmlkfachpnlekmgfekgvtsief
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylyA (A:)
    apflnpkkqkaaelkekikishdvtlfrfglehdeqllglptgkhmlirkkvtevvmray
    tpttanetrghfdlvvkiykanvhpkfpeggkfsqilealevgdtvevkgpighfhydrp
    ghyknhklesevkrinmiaggtgltpmyqvmkailsnpsdlteirllyanqteadillrp
    elealakshpdrvkihytvdrptpgwkyssgfidldmceralfryepgtisvlcgpppml
    kfachpnlekmgfekgvtsief
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ylyB (B:)
    gamdaavvvmpgtaaaplpaidvdapflnpkkqkaaelkekikishdvtlfrfglehdeq
    llglptgkhmlirkkvtnaegdeevvmraytpttanetrghfdlvvkiykanvhpkfpeg
    gkfsqilealevgdtvevkgpighfhydrpghyknhklesevkrinmiaggtgltpmyqv
    mkailsnpsdlteirllyanqteadillrpelealakshpdrvkihytvdrptpgwkyss
    gfidldmceralfryepgtisvlcgpppmlkfachpnlekmgfekgvtsief
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylyB (B:)
    dapflnpkkqkaaelkekikishdvtlfrfglehdeqllglptgkhmlirkkvtnaegde
    evvmraytpttanetrghfdlvvkiykanvhpkfpeggkfsqilealevgdtvevkgpig
    hfhydrpghyknhklesevkrinmiaggtgltpmyqvmkailsnpsdlteirllyanqte
    adillrpelealakshpdrvkihytvdrptpgwkyssgfidldmceralfryepgtisvl
    cgpppmlkfachpnlekmgfekgvtsief