PDB entry 5ylw

View 5ylw on RCSB PDB site
Description: CYP76AH1 from Salvia miltiorrhiza
Class: oxidoreductase
Keywords: P450, monoxygenase, BIOSYNTHETIC PROTEIN, OXIDOREDUCTASE
Deposited on 2017-10-20, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferruginol synthase
    Species: Salvia miltiorrhiza [TaxId:226208]
    Gene: CYP76AH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ylwa_
  • Heterogens: HEM, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ylwA (A:)
    mdsfpllaalffiaatitflsfrrrrnlppgpfpypivgnmlqlganphqvfaklskryg
    plmsihlgslytvivsspemakeilhrhgqvfsgrtiaqavhacdhdkismgflpvasew
    rdmrkickeqmfsnqsmeasqglrrqklqqlldhvqkcsdsgravdireaafittlnlms
    atlfssqatefdskatmefkeiiegvativgvpnfadyfpilrpfdpqgvkrradvffgk
    llakiegylnerleskranpnapkkddfleivvdiiqanefklkthhfthlmldlfvggs
    dtnttsiewamselvmnpdkmarlkaelksvagdekivdesampklpylqavikevmrih
    ppgplllprkaesdqevngylipkgtqilinayaigrdpsiwtdpetfdperfldnkidf
    kgqdyellpfgsgrrvcpgmplatrilhmatatlvhnfdwkleddstaaadhagelfgva
    vrravplriipivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylwA (A:)
    lppgpfpypivgnmlqlganphqvfaklskrygplmsihlgslytvivsspemakeilhr
    hgqvfsgrtiaqavhacdhdkismgflpvasewrdmrkickeqmfsnqsmeasqglrrqk
    lqqlldhvqkcsdsgravdireaafittlnlmsatlfssqatefdskatmefkeiiegva
    tivgvpnfadyfpilrpfdpqgvkrradvffgkllakiegylnerleskranpnapkkdd
    fleivvdiiqanefklkthhfthlmldlfvggsdtnttsiewamselvmnpdkmarlkae
    lksvagdekivdesampklpylqavikevmrihppgplllprkaesdqevngylipkgtq
    ilinayaigrdpsiwtdpetfdperfldnkidfkgqdyellpfgsgrrvcpgmplatril
    hmatatlvhnfdwkleddstaaadhagelfgvavrravplriipiv