PDB entry 5ylt

View 5ylt on RCSB PDB site
Description: Crystal structure of SET7/9 in complex with a cyproheptadine derivative
Class: transferase/transferase inhibitor
Keywords: Set domain, methyltransferase, inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-10-19, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.6900000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ylta1, d5ylta2
  • Heterogens: SFG, C7N, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yltA (A:)
    gssgssgkdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidge
    miegklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesli
    ssageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynh
    vskycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppg
    ksgpeapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yltA (A:)
    rhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlms
    teegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskv
    avgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghk
    anhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksapewyqvel
    kafqatq