PDB entry 5ylo

View 5ylo on RCSB PDB site
Description: Structural of Pseudomonas aeruginosa PA4980
Class: hydrolase
Keywords: enoyl-CoA hydratase activity, fatty acid beta-oxidation, HYDROLASE
Deposited on 2017-10-18, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable enoyl-CoA hydratase/isomerase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA4980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yloa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yloA (A:)
    mtdlsplqtrveagiawlvlnrpqqrnaldiptlealhvrldacerdpavravvlggsgr
    sfcagadlaewaaaeargelesygwteaahalmgrlhaldkptvaavngsavgagmdlal
    ccdfriaaasarfkagytgmaycpdagaswhlprllgseaakrllfldeawsaeralgag
    lvgevvadehlveavgafaarlasgptfafaqtkrllrdgagrslaeqlraeqaagllcg
    rsedaaealravaekrspqfsgrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yloA (A:)
    mtdlsplqtrveagiawlvlnrpqqrnaldiptlealhvrldacerdpavravvlggsgr
    sfcagadlaewaaaeargelesygwteaahalmgrlhaldkptvaavngsavgagmdlal
    ccdfriaaasarfkagytgmaycpdagaswhlprllgseaakrllfldeawsaeralgag
    lvgevvadehlveavgafaarlasgptfafaqtkrllrdgagrslaeqlraeqaa