PDB entry 5ylg

View 5ylg on RCSB PDB site
Description: Crystal Structure of LysM domain from pteris ryukyuensis chitinase A
Class: sugar binding protein
Keywords: CBM, Chitinase, LysM, PLANT PROTEIN, SUGAR BINDING PROTEIN
Deposited on 2017-10-17, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Pteris ryukyuensis [TaxId:367335]
    Gene: prchiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ylga_
  • Chain 'B':
    Compound: chitinase a
    Species: Pteris ryukyuensis [TaxId:367335]
    Gene: prchiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ylgb_
  • Chain 'C':
    Compound: chitinase a
    Species: Pteris ryukyuensis [TaxId:367335]
    Gene: prchiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ylgc_
  • Chain 'D':
    Compound: chitinase a
    Species: Pteris ryukyuensis [TaxId:367335]
    Gene: prchiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ylgd_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ylgA (A:)
    mcttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylgA (A:)
    cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ylgB (B:)
    mcttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylgB (B:)
    ttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ylgC (C:)
    mcttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylgC (C:)
    ttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ylgD (D:)
    mcttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ylgD (D:)
    cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk