PDB entry 5ykw

View 5ykw on RCSB PDB site
Description: Structural basis of the thiol resolving mechanism in yeast mitochondrial 1-Cys peroxiredoxin via glutathione/thioredoxin systems
Class: transferase
Keywords: Saccharomyces cerevisiae, 1-Cys Peroxiredoxin, Thioredoxin, glutathione, TRANSFERASE
Deposited on 2017-10-16, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-3, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TRX3, YCR083W, YCR83W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25372 (0-105)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d5ykwa_
  • Chain 'B':
    Compound: peptide THR-PRO-VAL-CYS-THR-THR-GLU-VAL
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: PRX1
    Database cross-references and differences (RAF-indexed):
    • PDB 5YKW (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ykwA (A:)
    ssytsitkltnltefrnlikqndklvidfyatwcgpskmmqphltkliqaypdvrfvkcd
    vdespdiakecevtamptfvlgkdgqligkiiganptalekgikdl
    

  • Chain 'B':
    No sequence available.