PDB entry 5ykj

View 5ykj on RCSB PDB site
Description: Structural basis of the thiol resolving mechanism in yeast mitochondrial 1-Cys peroxiredoxin via glutathione/thioredoxin systems
Class: transferase
Keywords: Saccharomyces cerevisiae, 1-Cys Peroxiredoxin, Thioredoxin, glutathione, TRANSFERASE
Deposited on 2017-10-14, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxiredoxin PRX1, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PRX1, YBL064C, YBL0503, YBL0524
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34227 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d5ykja1, d5ykja2
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ykjA (A:)
    mlrinsdapnfdadttvgkinfydylgdswgvlfshpadftpvcttevsafaklkpefdk
    rnvkliglsvedveshekwiqdikeiakvknvgfpiigdtfrnvaflydmvdaegfknin
    dgslktvrsvfvidpkkkirliftypstvgrntsevlrvidalqltdkegvvtpinwqpa
    ddviippsvsndeakakfgqfneikpylrftksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ykjA (A:)
    mlrinsdapnfdadttvgkinfydylgdswgvlfshpadftpvcttevsafaklkpefdk
    rnvkliglsvedveshekwiqdikeiakvknvgfpiigdtfrnvaflydmvdaegfknin
    dgslktvrsvfvidpkkkirliftypstvgrntsevlrvidalqltdkegvvtpinwqpa
    ddviippsvsndeakakfgqfneikpylrftks