PDB entry 5yji

View 5yji on RCSB PDB site
Description: Co-crystal structure of Mouse Nicotinamide N-methyltransferase (NNMT) with small molecule analog of Nicotinamide
Class: transferase
Keywords: nnmt, na, mna, t2d, transferase
Deposited on 2017-10-10, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinamide N-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Nnmt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yjia_
  • Chain 'B':
    Compound: Nicotinamide N-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Nnmt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yjib_
  • Heterogens: 8WO, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yjiA (A:)
    mgsshhhhhhssglvprgshmesgftskdtylshfnprdylekyysfgsrhcaeneilrh
    llknlfkifclgavkgellidigsgptiyqllsacesfteiivsdytdqnlwelqkwlkk
    epgafdwspvvtyvcdlegnrmkgpekeeklrraikqvlkcdvtqsqplggvslppadcl
    lstlcldaacpdlpayrtalrnlgsllkpggflvmvdalkssyymigeqkfsslplgwet
    vrdaveeagytieqfevisqnyssttsnneglfslvgrkpgrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjiA (A:)
    ftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidigs
    gptiyqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmkg
    pekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnlg
    sllkpggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnyss
    ttsnneglfslvgrkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yjiB (B:)
    mgsshhhhhhssglvprgshmesgftskdtylshfnprdylekyysfgsrhcaeneilrh
    llknlfkifclgavkgellidigsgptiyqllsacesfteiivsdytdqnlwelqkwlkk
    epgafdwspvvtyvcdlegnrmkgpekeeklrraikqvlkcdvtqsqplggvslppadcl
    lstlcldaacpdlpayrtalrnlgsllkpggflvmvdalkssyymigeqkfsslplgwet
    vrdaveeagytieqfevisqnyssttsnneglfslvgrkpgrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjiB (B:)
    ftskdtylshfnprdylekyyshcaeneilrhllknlfkifclgavkgellidigsgpti
    yqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmkgpeke
    eklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnlgsllk
    pggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnyssttsn
    neglfslvgrkp