PDB entry 5yjf

View 5yjf on RCSB PDB site
Description: Co-crystal structure of Human Nicotinamide N-methyltransferase (NNMT) with small molecule analog of Nicotinamide
Class: transferase
Keywords: nnmt, na, mna, t2d, transferase
Deposited on 2017-10-10, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinamide N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: Nnmt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40261
      • engineered mutation (119-120)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d5yjfa_
  • Chain 'B':
    Compound: Nicotinamide N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: Nnmt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40261
      • engineered mutation (119-120)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d5yjfb_
  • Chain 'C':
    Compound: Nicotinamide N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: Nnmt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40261
      • engineered mutation (119-120)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d5yjfc_
  • Chain 'D':
    Compound: Nicotinamide N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: Nnmt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40261
      • engineered mutation (119-120)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d5yjfd_
  • Heterogens: 8WO, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yjfA (A:)
    mgsshhhhhhssglvprgshmesgftskdtylshfnprdylekyykfgsrhsaesqilkh
    llknlfkifcldgvkgdllidigsgptiyqllsacesfkeivvtdysdqnlqelekwlka
    apaafdwspvvtyvcdlegnrvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcv
    lstlcldaacpdlptycralrnlgsllkpggflvimdalkssyymigeqkfsslplgrea
    veaavkeagytiewfevisqsysstmanneglfslvarklsrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjfA (A:)
    ftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidigs
    gptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkg
    pekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlg
    sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
    tmanneglfslvarkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yjfB (B:)
    mgsshhhhhhssglvprgshmesgftskdtylshfnprdylekyykfgsrhsaesqilkh
    llknlfkifcldgvkgdllidigsgptiyqllsacesfkeivvtdysdqnlqelekwlka
    apaafdwspvvtyvcdlegnrvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcv
    lstlcldaacpdlptycralrnlgsllkpggflvimdalkssyymigeqkfsslplgrea
    veaavkeagytiewfevisqsysstmanneglfslvarklsrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjfB (B:)
    ftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidigs
    gptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkg
    pekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlg
    sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
    tmanneglfslvarkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yjfC (C:)
    mgsshhhhhhssglvprgshmesgftskdtylshfnprdylekyykfgsrhsaesqilkh
    llknlfkifcldgvkgdllidigsgptiyqllsacesfkeivvtdysdqnlqelekwlka
    apaafdwspvvtyvcdlegnrvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcv
    lstlcldaacpdlptycralrnlgsllkpggflvimdalkssyymigeqkfsslplgrea
    veaavkeagytiewfevisqsysstmanneglfslvarklsrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjfC (C:)
    ftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidigs
    gptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkg
    pekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlg
    sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
    tmanneglfslvarkls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yjfD (D:)
    mgsshhhhhhssglvprgshmesgftskdtylshfnprdylekyykfgsrhsaesqilkh
    llknlfkifcldgvkgdllidigsgptiyqllsacesfkeivvtdysdqnlqelekwlka
    apaafdwspvvtyvcdlegnrvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcv
    lstlcldaacpdlptycralrnlgsllkpggflvimdalkssyymigeqkfsslplgrea
    veaavkeagytiewfevisqsysstmanneglfslvarklsrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjfD (D:)
    ftskdtylshfnprdylekyykfhsaesqilkhllknlfkifcldgvkgdllidigsgpt
    iyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkgpek
    eeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlgsll
    kpggflvimdalkssyymieqkfsslplgreaveaavkeagytiewfevisqsysstman
    neglfslvarkl