PDB entry 5yj8

View 5yj8 on RCSB PDB site
Description: Identification of a small molecule inhibitor for the Tudor domain of TDRD3
Class: transcription/inhibitor
Keywords: Transcriptional coactivator, complex, inhibitor, TRANSCRIPTION-INHIBITOR complex
Deposited on 2017-10-09, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Tdrd3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7E2 (6-59)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d5yj8a1, d5yj8a2
  • Heterogens: 8W9, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yj8A (A:)
    hhhhhmmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi