PDB entry 5yiy

View 5yiy on RCSB PDB site
Description: Crystal structure of D175A mutant of Rv3272 from Mycobacterium tuberculosis
Class: transferase
Keywords: CoA transferases, D175A, Rv3272, Mycobacterium, TRANSFERASE
Deposited on 2017-10-06, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CoA transferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96877 (Start-393)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5yiya_
  • Chain 'B':
    Compound: CoA transferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96877
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5yiyb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yiyA (A:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yiyA (A:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlplatyflp
    nnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliya
    rltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasghvlaqavla
    allhrerngvadvvqvamydvavglqanqlmmhlnratqpsdafrtadgyivisayvpkh
    wqklcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmac
    lahtwkqvvdtplfaendltlevgrgadtitvirtparyasfravvtdppptagehnavf
    larp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yiyB (B:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yiyB (B:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpatyflpn
    nrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyar
    ltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasghvlaqavlaa
    llhrerngvadvvqvamydvavglqanqlmmhlnatqpsdafrtadgyivisayvpkhwq
    klcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmacla
    htwkqvvdtplfaendltlevgrgadtitvirtparyasfravvtdppptagehnavfla
    r