PDB entry 5yit

View 5yit on RCSB PDB site
Description: Crystal Structure of Hypothetical protein (Rv3272) from Mycobacterium tuberculosis
Class: transferase
Keywords: CoA transferase Family III, interlocked dimer, Mycobacterium tuberculosis, Rv3272, TRANSFERASE
Deposited on 2017-10-06, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CoA transferase III
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yita_
  • Chain 'B':
    Compound: CoA transferase III
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yitb_
  • Chain 'C':
    Compound: CoA transferase III
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yitc_
  • Chain 'D':
    Compound: CoA transferase III
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yitd_
  • Chain 'E':
    Compound: CoA transferase III
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yite_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yitA (A:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yitA (A:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitplatyflpnnr
    gkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarlt
    ayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaall
    hrerngvadvvqvamydvavglqanqlmmhlnraqpsdafrtadgyivispkhwqklcyl
    igrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclahtwkq
    vvdtplfaendltlevgtitvirtparyasfravvtdppptagehnavfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yitB (B:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yitB (B:)
    snpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitstyflpnnrg
    kksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarlta
    yggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaallh
    rerngvadvvqvamydvavglqanqlmmhlnratqpsdafrtadgyivisayvpkhwqkl
    cyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclaht
    wkqvvdtplfaendltlevgtitvirtparyasfravvtdppptagehnavfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yitC (C:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yitC (C:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlptyflpnn
    rgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarl
    tayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaal
    lhrerngvadvvqvamydvavglqanqlmmhlnratqpsdafrtadgyivisayvpkhwq
    klcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmacla
    htwkqvvdtplfaendltlevtitvirtparyasfravvtdppptagehnavfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yitD (D:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yitD (D:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitpplatyflpnn
    rgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarl
    tayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaal
    lhrerngvadvvqvamydvavglqanqlmmhlnrtqpsdafrtadgyivisayvpkhwqk
    lcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclah
    twkqvvdtplfaendltlevtitvirtparyasfravvtdppptagehnavf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5yitE (E:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yitE (E:)
    pakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqilatyflpnnrgkk
    svtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarltayg
    gngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaallhre
    rngvadvvqvamydvavglqanqlmmhlnrtqpsdafrtadgyivisayvpkhwqklcyl
    igrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclahtwkq
    vvdtplfaendltlitvirtparyasfravvtdppptagehnav