PDB entry 5yir

View 5yir on RCSB PDB site
Description: Crystal Structure of AnkB LIR/GABARAP complex
Class: protein binding
Keywords: Autophagy, PROTEIN BINDING
Deposited on 2017-10-06, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Gabarap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yira_
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Gabarap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yirb_
  • Chain 'C':
    Compound: Ankyrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Gabarap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yird_
  • Chain 'G':
    Compound: Ankyrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Ankyrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANK2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yirA (A:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yirB (B:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yirD (D:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.