PDB entry 5yid

View 5yid on RCSB PDB site
Description: Crystal Structure of KNI-10395 bound Plasmepsin II (PMII) from Plasmodium falciparum
Class: hydrolase
Keywords: Plasmepsin, Plasmepsin II, KNI-10395, Aspartic Protease, Plasmodium falciparum, Drug Development, inhibitor, HYDROLASE
Deposited on 2017-10-04, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF14_0077, PF3D7_1408000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yida_
  • Heterogens: K95, CPS, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5yidA (A:)
ndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssk
srtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdg
ilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpl
tyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpfl
pfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilg
dpfmrkyftvfdydnqsvgialakknl