PDB entry 5yia

View 5yia on RCSB PDB site
Description: Crystal Structure of KNI-10343 bound Plasmepsin II (PMII) from Plasmodium falciparum
Class: hydrolase
Keywords: Plasmepsin, Plasmepsin II, KNI-10343, Aspartic Protease, Plasmodium falciparum, Drug Development, inhibitor, HYDROLASE
Deposited on 2017-10-03, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF14_0077, PF3D7_1408000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yiaa_
  • Heterogens: 8V9, CPS, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5yiaA (A:)
sndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydss
ksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfd
gilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegp
ltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpf
lpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfil
gdpfmrkyftvfdydnqsvgialakknl