PDB entry 5yhk

View 5yhk on RCSB PDB site
Description: Crystal structure of acetolactate decarboxylase from Enterbacter aerogenes
Class: metal binding protein
Keywords: acetolactate decarboxylase Enterbacter aerogenes, METAL BINDING PROTEIN
Deposited on 2017-09-28, released 2018-10-10
Made obsolete by 6j92 on 2020-12-09

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-acetolactate decarboxylase
    Species: Klebsiella aerogenes [TaxId:548]
    Gene: budA, aldC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yhka_
  • Chain 'B':
    Compound: alpha-acetolactate decarboxylase
    Species: Klebsiella aerogenes [TaxId:548]
    Gene: budA, aldC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yhkb_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yhkA (A:)
    akhpdsviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlr
    adgsaraakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridg
    nfrhahtrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehf
    itddrqggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsven
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhkA (A:)
    sviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlradgsa
    raakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridgnfrha
    htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr
    qggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsven
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yhkB (B:)
    akhpdsviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlr
    adgsaraakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridg
    nfrhahtrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehf
    itddrqggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsven
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhkB (B:)
    sviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlradgsa
    raakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridgnfrha
    htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr
    qggghlldyqlesgvltfgeihklmidlp