PDB entry 5yhi

View 5yhi on RCSB PDB site
Description: Crystal structure of YiiM from Escherichia coli
Class: oxidoreductase
Keywords: enzyme, MOSC, OXIDOREDUCTASE
Deposited on 2017-09-28, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein YiiM
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: yiiM, b3910, JW5559
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157 (6-229)
      • expression tag (5)
    Domains in SCOPe 2.07: d5yhia1, d5yhia2
  • Chain 'B':
    Compound: Protein YiiM
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: yiiM, b3910, JW5559
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32157 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d5yhib1, d5yhib2
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yhiA (A:)
    gsakdpmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekkvhggpd
    ralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvs
    qprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqea
    aaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhiA (A:)
    pmrypvdvytgkiqvdgelmltelglegdgpdralchyprehylywarefpeqaelfvap
    afgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisdiaqlmqntgkv
    gwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrllsaaglskswt
    rtmqkrrlsgkiedfsrrlwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yhiB (B:)
    gsakdpmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekkvhggpd
    ralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvs
    qprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqea
    aaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhiB (B:)
    pmrypvdvytgkiqvdgelmltelglegdgpdralchyprehylywarefpeqaelfvap
    afgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisdiaqlmqntgkv
    gwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrllsaaglskswt
    rtmqkrrlsgkiedfsrrlwg