PDB entry 5yh5

View 5yh5 on RCSB PDB site
Description: The crystal structure of Staphylococcus aureus CntA in apo form
Class: metal binding protein
Keywords: Staphylococcus aureus, receptor, METAL BINDING PROTEIN
Deposited on 2017-09-27, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel ABC transporter substrate-binding protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: opp-1A, AYM28_13740, AYM37_13740, ERS072738_00487, ERS074020_00717, HMPREF3211_02361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yh5a_
  • Heterogens: EDO, PEG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yh5A (A:)
    gleekkenkqltyttvkdigdmnphvyggsmsaesmiyeplvrntkdgikpllakkwdvs
    edgktytfhlrddvkfhdgtpfdadavkknidavqenkklhswlkistlidnvkvkdkyt
    velnlkeayqpalaelamprpyvfvspkdfkngttkdgvkkfdgtgpfklgehkkdesad
    fnkndqywgeksklnkvqakvmpagetaflsmkkgetnfaftddrgtdsldkdslkqlkd
    tgdyqvkrsqpmntkmlvvnsgkkdnavsdktvrqaighmvnrdkiakeildgqekpatq
    lfaknvtdinfdmptrkydlkkaeslldeagwkkgkdsdvrqkdgknlemamyydkgsss
    qkeqaeylqaefkkmgiklningetsdkiaerrtsgdydlmfnqtwgllydpqstiaafk
    akngyesatsgienkdkiynsiddafkiqngkersdayknilkqiddegifipishgsmt
    vvapkdlekvsftqsqyelpfnemqyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yh5A (A:)
    gleekkenkqltyttvkdigdmnphvyggsmsaesmiyeplvrntkdgikpllakkwdvs
    edgktytfhlrddvkfhdgtpfdadavkknidavqenkklhswlkistlidnvkvkdkyt
    velnlkeayqpalaelamprpyvfvspkdfkngttkdgvkkfdgtgpfklgehkkdesad
    fnkndqywgeksklnkvqakvmpagetaflsmkkgetnfaftddrgtdsldkdslkqlkd
    tgdyqvkrsqpmntkmlvvnsgkkdnavsdktvrqaighmvnrdkiakeildgqekpatq
    lfaknvtdinfdmptrkydlkkaeslldeagwkdsdvrqkdgknlemamyydkgsssqke
    qaeylqaefkkmgiklningetsdkiaerrtsgdydlmfnqtwgllydpqstiaafkakn
    gyesatsgienkdkiynsiddafkiqngkersdayknilkqiddegifipishgsmtvva
    pkdlekvsftqsqyelpfnemqy