PDB entry 5ygu

View 5ygu on RCSB PDB site
Description: Crystal structure of Escherichia coli (strain K12) mRNA Decapping Complex RppH-DapF
Class: isomerase/hydrolase
Keywords: RppH-DapF, Decapping, Hydrolase, ISOMERASE-HYDROLASE complex
Deposited on 2017-09-27, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: dapF, b3809, JW5592
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ygua1, d5ygua2
  • Chain 'B':
    Compound: RNA pyrophosphohydrolase
    Species: Escherichia coli [TaxId:83333]
    Gene: rppH, nudH, ygdP, b2830, JW2798
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A776 (0-157)
      • engineered mutation (15)
  • Heterogens: TLA, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yguA (A:)
    mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
    rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
    pnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvle
    sherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrv
    elpggrldiawkgpghplymtgpavhvydgfihl
    

  • Chain 'B':
    No sequence available.