PDB entry 5ygi

View 5ygi on RCSB PDB site
Description: Crystal structure of human FPPS in complex with an inhibitor THZ93
Class: transferase/transferase inhibitor
Keywords: THZ93, Complex, human FPPS, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-09-23, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ygia_
  • Heterogens: PO4, MG, T93, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ygiA (A:)
    nsdvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvv
    vafrelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvg
    ldaindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdl
    vrftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddy
    ldlfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkaly
    eeldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ygiA (A:)
    dvyaqekqdfvqhfsqivrvltehpeigdaiarlkevleynaiggkynrgltvvvafrel
    veprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldaind
    anlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrftek
    ryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlfgd
    psvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeldlp
    avflqyeedsyshimalieqyaaplppavflglarkiy