PDB entry 5ygh

View 5ygh on RCSB PDB site
Description: Crystal Structure of the Capsid Protein from Zika Virus
Class: viral protein
Keywords: Zika virus, capsid (C), RNA binding protein, virus assembly, VIRAL PROTEIN
Deposited on 2017-09-23, released 2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ygha_
  • Chain 'B':
    Compound: capsid protein
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yghb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yghA (A:)
    rvspfgglkrlpaglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiik
    kfkkdlaamlriinar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yghA (A:)
    pfgglkrlpaglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiikkfk
    kdlaamlriinar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yghB (B:)
    rvspfgglkrlpaglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiik
    kfkkdlaamlriinar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yghB (B:)
    pfgglkrlpaglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiikkfk
    kdlaamlriinar