PDB entry 5yg3

View 5yg3 on RCSB PDB site
Description: Plasmodium vivax SHMT bound with PLP-glycine and S-GS834
Class: transferase/inhibitor
Keywords: alpha and beta protein, Transferase, methyltransferase activity, Inhibitor, TRANSFERASE-INHIBITOR complex
Deposited on 2017-09-22, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yg3a_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yg3b_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: PVC01_140059500, PVP01_1453700, PVT01_140059000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yg3c_
  • Heterogens: PLG, 8UC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yg3A (A:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yg3B (B:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yg3C (C:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp