PDB entry 5yfk

View 5yfk on RCSB PDB site
Description: X-ray structure of a mutant form C232S of Clostridium perfringens sortase B
Class: transferase
Keywords: cystein transpeptidase, sortase, TRANSFERASE
Deposited on 2017-09-21, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Sortase B
    Species: Clostridium perfringens (strain 13 / Type A) [TaxId:195102]
    Gene: CPE0513
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XN25 (Start-225)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d5yfka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yfkA (A:)
    mkiyqkrleyytdsrdydnlrslsplsdssvnkspeehkqdaeseknlkninpdyrfwik
    vegtnidfpvvqgkdndfylhhnfnkeksfsgsifvdsennlnddsnivvyghnmrndtm
    faqikhfknenffnankyvtlyregkkstfeifsvyqenakdleseiktkfsnkedyeky
    lkeqeskslfkrdgidlnsndriltlitsgydfvnarivvvakeidlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yfkA (A:)
    yytdsrdydnlrslsplsspeehkqdaeseknlkninpdyrfwikvegtnidfpvvqgkd
    ndfylhhnfnkeksfsgsifvdsennlnddsnivvyghnmrndtmfaqikhfknenffna
    nkyvtlyregkkstfeifsvyqenakdleseiktkfsnkedyekylkeqeskslfkrdgi
    dlnsndriltlitsgydfvnarivvvakeid