PDB entry 5yfe

View 5yfe on RCSB PDB site
Description: Enzymatic and structural characterization of the poly (ethylene terephthalate) hydrolase PETase from I. sakaiensis
Class: hydrolase
Keywords: PET degradation, HYDROLASE
Deposited on 2017-09-21, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K8P6T7 (0-263)
      • engineered mutation (45)
      • engineered mutation (197)
      • engineered mutation (260)
      • expression tag (264-267)
    Domains in SCOPe 2.07: d5yfea1, d5yfea2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yfeA (A:)
    aqtnpyargpnptaasleasagpftvrsftvsrpsgygagtvyypnnaggtvgaiaivpg
    ytarqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiy
    gkvdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacend
    siapvnssalpiydsmsanakqfleinggshscansgnsnqaligkkgvawmkrfmdndt
    rystfacenpnstrvsdfrtnncslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yfeA (A:)
    aqtnpyargpnptaasleasagpftvrsftvsrpsgygagtvyypnnaggtvgaiaivpg
    ytarqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiy
    gkvdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacend
    siapvnssalpiydsmsanakqfleinggshscansgnsnqaligkkgvawmkrfmdndt
    rystfacenpnstrvsdfrtnncslehh