PDB entry 5yeq

View 5yeq on RCSB PDB site
Description: The structure of Sac-KARI protein
Class: isomerase
Keywords: reductase, AHIR, NADH, NADPH, branched-chain amino acids, BCAA, biofuel, knot domain, metal ion cofactor, acid tolerant enzyme, ISOMERASE
Deposited on 2017-09-19, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: ilvC, ATY89_10310, ATZ20_01865
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yeqa1, d5yeqa2
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase (NADP(+))
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: ilvC, ATY89_10310, ATZ20_01865
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yeqb1, d5yeqb2
  • Heterogens: SO4, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yeqA (A:)
    makiytdkdvsldvikekrvavlgygsqgrawalnlrdsgikvsvgleregnswkqaend
    gfkplrteeavrnsdiiifllpdmiqrtvylervkpylkegmdlvfahgfnihyrliepp
    snvdvymiapkapgpivreyfakgggvpalvatyqdhsgkalqkalavakaigatragvi
    ettfkeetetdlfgeqvdlvggvmqlmryafqtlveagyqpevayfetinemklivdlvy
    ekgfsgmltavsdtakyggmtvgkmvidesvkermkkaldnirsgkfaekwveeygkgan
    tikegmkevdnsteekvgrslrdiilrgkpkslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yeqA (A:)
    akiytdkdvsldvikekrvavlgygsqgrawalnlrdsgikvsvgleregnswkqaendg
    fkplrteeavrnsdiiifllpdmiqrtvylervkpylkegmdlvfahgfnihyrliepps
    nvdvymiapkapgpivreyfakgggvpalvatyqdhsgkalqkalavakaigatragvie
    ttfkeetetdlfgeqvdlvggvmqlmryafqtlveagyqpevayfetinemklivdlvye
    kgfsgmltavsdtakyggmtvgkmvidesvkermkkaldnirsgkfaekwveeygkgant
    ikegmkevdnsteekvgrslrdiilrgkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yeqB (B:)
    makiytdkdvsldvikekrvavlgygsqgrawalnlrdsgikvsvgleregnswkqaend
    gfkplrteeavrnsdiiifllpdmiqrtvylervkpylkegmdlvfahgfnihyrliepp
    snvdvymiapkapgpivreyfakgggvpalvatyqdhsgkalqkalavakaigatragvi
    ettfkeetetdlfgeqvdlvggvmqlmryafqtlveagyqpevayfetinemklivdlvy
    ekgfsgmltavsdtakyggmtvgkmvidesvkermkkaldnirsgkfaekwveeygkgan
    tikegmkevdnsteekvgrslrdiilrgkpkslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yeqB (B:)
    akiytdkdvsldvikekrvavlgygsqgrawalnlrdsgikvsvgleregnswkqaendg
    fkplrteeavrnsdiiifllpdmiqrtvylervkpylkegmdlvfahgfnihyrliepps
    nvdvymiapkapgpivreyfakgggvpalvatyqdhsgkalqkalavakaigatragvie
    ttfkeetetdlfgeqvdlvggvmqlmryafqtlveagyqpevayfetinemklivdlvye
    kgfsgmltavsdtakyggmtvgkmvidesvkermkkaldnirsgkfaekwveeygkgant
    ikegmkevdnsteekvgrslrdiilrgkp