PDB entry 5ydj

View 5ydj on RCSB PDB site
Description: Crystal structure of anopheles gambiae acetylcholinesterase in complex with PMSF
Class: hydrolase
Keywords: acetylcholinesterase pmsf, hydrolase
Deposited on 2017-09-13, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Anopheles gambiae [TaxId:7165]
    Gene: Ace, ACE1, ACHE1, AGAP001356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ydja_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Anopheles gambiae [TaxId:7165]
    Gene: Ace, ACE1, ACHE1, AGAP001356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ydjb_
  • Heterogens: NAG, SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ydjA (A:)
    meirgllmgrlrlgrrmvplgllgvtalllilppfalvqgrhhelnngaaigshqlsaaa
    gvglasqsaqsgslasgvmssvpaagasssssssllsssaeddvaritlskdadafftpy
    ighgesvriidaelgtlehvhsgatprrrgltrresnsdandndplvvntdkgrirgitv
    dapsgkkvdvwlgipyaqppvgplrfrhprpaekwtgvlntttppnscvqivdtvfgdfp
    gatmwnpntplsedclyinvvaprprpknaavmlwifgggfysgtatldvydhralasee
    nvivvslqyrvaslgflflgtpeapgnaglfdqnlalrwvrdnihrfggdpsrvtlfges
    agavsvslhllsalsrdlfqrailqsgsptapwalvsreeatlralrlaeavgcphepsk
    lsdaveclrgkdphvlvnnewgtlgicefpfvpvvdgafldetpqrslasgrfkkteilt
    gsnteegyyfiiyyltellrkeegvtvtreeflqavrelnpyvngaarqaivfeytdwte
    pdnpnsnrdaldkmvgdyhftcnvnefaqryaeegnnvymylythrskgnpwprwtgvmh
    gdeinyvfgeplnptlgytedekdfsrkimrywsnfaktgnpnpntassefpewpkhtah
    grhylelglntsfvgrgprlrqcafwkkylpqlvaatsnlpgpappsepcessaffyrpd
    livllvslltatvrfiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ydjA (A:)
    dndplvvntdkgrirgitvdapsgkkvdvwlgipyaqppvgplrfrhprpaekwtgvlnt
    ttppnscvqivdtvfgdfpgatmwnpntplsedclyinvvaprprpknaavmlwifgggf
    ysgtatldvydhralaseenvivvslqyrvaslgflflgtpeapgnaglfdqnlalrwvr
    dnihrfggdpsrvtlfgesagavsvslhllsalsrdlfqrailqsgsptapwalvsreea
    tlralrlaeavgcphepsklsdaveclrgkdphvlvnnewgtlgicefpfvpvvdgafld
    etpqrslasgrfkkteiltgsnteegyyfiiyyltellrkeegvtvtreeflqavrelnp
    yvngaarqaivfeytdwtepdnpnsnrdaldkmvgdyhftcnvnefaqryaeegnnvymy
    lythrskgnpwprwtgvmhgdeinyvfgeplnptlgytedekdfsrkimrywsnfaktgn
    pnpntassefpewpkhtahgrhylelglntsfvgrgprlrqcafwkkylpqlvaatsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ydjB (B:)
    meirgllmgrlrlgrrmvplgllgvtalllilppfalvqgrhhelnngaaigshqlsaaa
    gvglasqsaqsgslasgvmssvpaagasssssssllsssaeddvaritlskdadafftpy
    ighgesvriidaelgtlehvhsgatprrrgltrresnsdandndplvvntdkgrirgitv
    dapsgkkvdvwlgipyaqppvgplrfrhprpaekwtgvlntttppnscvqivdtvfgdfp
    gatmwnpntplsedclyinvvaprprpknaavmlwifgggfysgtatldvydhralasee
    nvivvslqyrvaslgflflgtpeapgnaglfdqnlalrwvrdnihrfggdpsrvtlfges
    agavsvslhllsalsrdlfqrailqsgsptapwalvsreeatlralrlaeavgcphepsk
    lsdaveclrgkdphvlvnnewgtlgicefpfvpvvdgafldetpqrslasgrfkkteilt
    gsnteegyyfiiyyltellrkeegvtvtreeflqavrelnpyvngaarqaivfeytdwte
    pdnpnsnrdaldkmvgdyhftcnvnefaqryaeegnnvymylythrskgnpwprwtgvmh
    gdeinyvfgeplnptlgytedekdfsrkimrywsnfaktgnpnpntassefpewpkhtah
    grhylelglntsfvgrgprlrqcafwkkylpqlvaatsnlpgpappsepcessaffyrpd
    livllvslltatvrfiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ydjB (B:)
    dndplvvntdkgrirgitvdapsgkkvdvwlgipyaqppvgplrfrhprpaekwtgvlnt
    ttppnscvqivdtvfgdfpgatmwnpntplsedclyinvvaprprpknaavmlwifgggf
    ysgtatldvydhralaseenvivvslqyrvaslgflflgtpeapgnaglfdqnlalrwvr
    dnihrfggdpsrvtlfgesagavsvslhllsalsrdlfqrailqsgsptapwalvsreea
    tlralrlaeavgcphepsklsdaveclrgkdphvlvnnewgtlgicefpfvpvvdgafld
    etpqrslasgrfkkteiltgsnteegyyfiiyyltellrkeegvtvtreeflqavrelnp
    yvngaarqaivfeytdwtepdnpnsnrdaldkmvgdyhftcnvnefaqryaeegnnvymy
    lythrskgnpwprwtgvmhgdeinyvfgeplnptlgytedekdfsrkimrywsnfaktgn
    pnpntassefpewpkhtahgrhylelglntsfvgrgprlrqcafwkkylpqlvaatsn