PDB entry 5yd6

View 5yd6 on RCSB PDB site
Description: Crystal structure of PG-bound Nurr1-LBD
Class: transcription
Keywords: nurr1, lbd, prostaglandin, transcription, michael addition
Deposited on 2017-09-11, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 4 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A2, NOT, NURR1, TINUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yd6a_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 4 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A2, NOT, NURR1, TINUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yd6b_
  • Chain 'C':
    Compound: Nuclear receptor subfamily 4 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A2, NOT, NURR1, TINUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yd6c_
  • Chain 'D':
    Compound: Nuclear receptor subfamily 4 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A2, NOT, NURR1, TINUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yd6d_
  • Heterogens: 8SU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yd6A (A:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yd6A (A:)
    vslisalvrahvdsnpamtsldysrfqanpddtqhiqqfydlltgsmeiirgwaekipgf
    adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
    efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfpnylsk
    llgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yd6B (B:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yd6B (B:)
    vslisalvrahvdsnpamtsldysrfqanpddtqhiqqfydlltgsmeiirgwaekipgf
    adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
    efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnnyls
    kllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yd6C (C:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yd6C (C:)
    ppvslisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgf
    adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
    efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnyl
    skllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yd6D (D:)
    mvkevvrtdslkgrrgrlpskpkspqepsppsppvslisalvrahvdsnpamtsldysrf
    qanpdyqmsgddtqhiqqfydlltgsmeiirgwaekipgfadlpkadqdllfesaflelf
    vlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsivefssnlqnmnidisafscia
    alamvterhglkepkrveelqnkivnclkdhvtfnngglnrpnylskllgklpelrtlct
    qglqrifylkledlvpppaiidklfldtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yd6D (D:)
    ppvslisalvrahvdsnpamtsldysrfqandtqhiqqfydlltgsmeiirgwaekipgf
    adlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsiv
    efssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnpnyl
    skllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf