PDB entry 5yd2

View 5yd2 on RCSB PDB site
Description: Crystal Structure of Delta 4 mutant of EhPSAT (Phosphoserine aminotransferase of Entamoeba histolytica)
Class: transferase
Keywords: Delta4_EhPSAT, TRANSFERASE
Deposited on 2017-09-10, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: ENTAMOEBA HISTOLYTICA HM-3:IMSS [TaxId:885315]
    Gene: KM1_040390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yd2a_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: ENTAMOEBA HISTOLYTICA HM-3:IMSS [TaxId:885315]
    Gene: KM1_040390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yd2b_
  • Heterogens: CL, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yd2A (A:)
    merqnihnfgamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdi
    pegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdk
    nytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysl
    iyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnq
    tlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykql
    enefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yd2A (A:)
    ihnfgamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdipegye
    ilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdknytyi
    peyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysliyaga
    qkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqtlkyi
    kkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqlenefs
    eyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yd2B (B:)
    merqnihnfgamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdi
    pegyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdk
    nytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysl
    iyagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnq
    tlkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykql
    enefseyalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlhth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yd2B (B:)
    hnfgamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdipegyei
    lffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdknytyip
    eyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysliyagaq
    kncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqtlkyik
    kigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqlenefse
    yalqkgiigikghrsvggfrasiynavtiesvqalikcmhdfeqlh