PDB entry 5yct

View 5yct on RCSB PDB site
Description: Engineered hairpin loop3 mutant monomer in Single-chain Monellin
Class: plant protein
Keywords: domain swapped dimer, Single-chain Monellin, loop mutation, QVVAG motif, PLANT PROTEIN
Deposited on 2017-09-08, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single chain monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCT
    Domains in SCOPe 2.07: d5ycta_
  • Chain 'B':
    Compound: Single chain monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCT
    Domains in SCOPe 2.07: d5yctb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yctA (A:)
    mgeweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgye
    yqlyvyasdklfradiseqvvaggrkllrfngpvpppstp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yctA (A:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
    qlyvyasdklfradiseqvvaggrkllrfngpvppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yctB (B:)
    mgeweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgye
    yqlyvyasdklfradiseqvvaggrkllrfngpvpppstp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yctB (B:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeeikgyeyqlyvy
    asdklfradiseqvvaggrkllrfngpvppp