PDB entry 5ycq

View 5ycq on RCSB PDB site
Description: Unique Specificity-Enhancing Factor for the AAA+ Lon Protease
Class: DNA binding protein
Keywords: heat shock protein, DNA BINDING PROTEIN
Deposited on 2017-09-08, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HspQ
    Species: Escherichia coli (strain 55989 / EAEC) [TaxId:585055]
    Gene: hspQ, EC55989_1015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ycqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ycqA (A:)
    miaskfgigqqvrhsllgylgvvvdidpvyslsepspdelavndelraapwyhvvmeddn
    glpvhtylaeaqlsselqdehpeqpsmdelaqtirkqlqaprlrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycqA (A:)
    askfgigqqvrhsllgylgvvvdidpvaapwyhvvmeddnglpvhtylaeaqlsselqde
    hpeqpsmdelaqtirkq