PDB entry 5ycf

View 5ycf on RCSB PDB site
Description: Crystal structure of Xiphophorus maculatus adenylate kinase
Class: transferase
Keywords: phosphorylation, TRANSFERASE
Deposited on 2017-09-07, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase isoenzyme 1
    Species: Xiphophorus maculatus [TaxId:8083]
    Gene: AK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ycfa_
  • Chain 'B':
    Compound: adenylate kinase isoenzyme 1
    Species: Xiphophorus maculatus [TaxId:8083]
    Gene: AK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ycfb_
  • Heterogens: AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ycfA (A:)
    madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
    kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
    dvfaqvskaidal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycfA (A:)
    ikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaimqkg
    elvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvdakaet
    mvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavddvfa
    qvskaidal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ycfB (B:)
    madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
    kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
    dvfaqvskaidal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycfB (B:)
    madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
    kaetmvkrllkrrsddneetikkrldlyykatepviafyegrgivkkvdselavddvfaq
    vskaidal