PDB entry 5ycd

View 5ycd on RCSB PDB site
Description: Crystal structure of Poecilia reticulata adenylate kinase
Class: transferase
Keywords: phosphorylation, TRANSFERASE
Deposited on 2017-09-07, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylayte kinase
    Species: Poecilia reticulata [TaxId:8081]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCD (Start-192)
    Domains in SCOPe 2.07: d5ycda_
  • Chain 'B':
    Compound: Adenylayte kinase
    Species: Poecilia reticulata [TaxId:8081]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCD (0-192)
    Domains in SCOPe 2.07: d5ycdb_
  • Heterogens: AP5, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ycdA (A:)
    madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
    kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
    dvfgqvskaidal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycdA (A:)
    dkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaimq
    kgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvdaka
    etmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavddv
    fgqvskaidal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ycdB (B:)
    madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
    kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
    dvfgqvskaidal