PDB entry 5yc5

View 5yc5 on RCSB PDB site
Description: Crystal structure of human IgG-Fc in complex with aglycan and optimized Fc gamma receptor IIIa
Class: immune system
Keywords: Immunoglobulin G; Fc receptor; Affinity chromatography; Protein glycosylation; Calorimetry; Protein dynamics, IMMUNE SYSTEM
Deposited on 2017-09-06, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yc5a1, d5yc5a2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yc5b1, d5yc5b2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A, CD16A, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (8)
      • engineered mutation (10)
      • engineered mutation (16)
      • engineered mutation (29)
      • engineered mutation (56)
      • engineered mutation (73)
      • engineered mutation (98)
      • engineered mutation (102)
      • engineered mutation (152)
      • varient (157)
    Domains in SCOPe 2.07: d5yc5c1, d5yc5c2
  • Heterogens: NAG, BMA, MAN, GAL, FUC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yc5A (A:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yc5A (A:)
    llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
    eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpp
    srdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvd
    ksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yc5B (B:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yc5B (B:)
    pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp
    reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytl
    ppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yc5C (C:)
    rtedlpkaevilepqwnrvlekdsvtlkcrgayspednstqwfhneslissqassylida
    atvddsgeyrcqtslstlsdpvqlevhigwlllqaprwefkegdpihlrchswkntalhk
    vtylqngkgrkyfhhnsdfyipkatlkdsgsyscrglvgsknvssetvnititqgghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yc5C (C:)
    dlpkaevilepqwnrvlekdsvtlkcrgayspednstqwfhneslissqassylidaatv
    ddsgeyrcqtslstlsdpvqlevhigwlllqaprwefkegdpihlrchswkntalhkvty
    lqngkgrkyfhhnsdfyipkatlkdsgsyscrglvgsknvssetvnititq