PDB entry 5yb9

View 5yb9 on RCSB PDB site
Description: Crystal structure of a dimeric cyclophilin A from T.vaginalis
Class: isomerase
Keywords: Cyclophilin A, Isomerase, Divergent loop cyclophilin, Dimeric cyclophilin
Deposited on 2017-09-04, released 2018-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.2800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_004440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yb9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yb9A (A:)
    gsmlkrpktffdisirgdkvgkivfelfndivpktaenfralctgekgigksgmplsykg
    tmfhriipqfmiqggdftrfngtggesiygmkfddenfkvkhdkpgllsmanagpntngs
    qffittvetpwldghhcvfgqviegmdivkqiescgtesgrpramcmvtdcgemk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yb9A (A:)
    mlkrpktffdisirgdkvgkivfelfndivpktaenfralctgekgigksgmplsykgtm
    fhriipqfmiqggdftrfngtggesiygmkfddenfkvkhdkpgllsmanagpntngsqf
    fittvetpwldghhcvfgqviegmdivkqiescgtesgrpramcmvtdcgem